Anti GXYLT2 pAb (ATL-HPA068429)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068429-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GXYLT2
Alternative Gene Name: GLT8D4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030074: 86%, ENSRNOG00000005621: 93%
Entrez Gene ID: 727936
Uniprot ID: A0PJZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ |
Gene Sequence | MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ |
Gene ID - Mouse | ENSMUSG00000030074 |
Gene ID - Rat | ENSRNOG00000005621 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GXYLT2 pAb (ATL-HPA068429) | |
Datasheet | Anti GXYLT2 pAb (ATL-HPA068429) Datasheet (External Link) |
Vendor Page | Anti GXYLT2 pAb (ATL-HPA068429) at Atlas Antibodies |
Documents & Links for Anti GXYLT2 pAb (ATL-HPA068429) | |
Datasheet | Anti GXYLT2 pAb (ATL-HPA068429) Datasheet (External Link) |
Vendor Page | Anti GXYLT2 pAb (ATL-HPA068429) |