Anti GXYLT2 pAb (ATL-HPA068429)

Atlas Antibodies

Catalog No.:
ATL-HPA068429-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glucoside xylosyltransferase 2
Gene Name: GXYLT2
Alternative Gene Name: GLT8D4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030074: 86%, ENSRNOG00000005621: 93%
Entrez Gene ID: 727936
Uniprot ID: A0PJZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ
Gene Sequence MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ
Gene ID - Mouse ENSMUSG00000030074
Gene ID - Rat ENSRNOG00000005621
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GXYLT2 pAb (ATL-HPA068429)
Datasheet Anti GXYLT2 pAb (ATL-HPA068429) Datasheet (External Link)
Vendor Page Anti GXYLT2 pAb (ATL-HPA068429) at Atlas Antibodies

Documents & Links for Anti GXYLT2 pAb (ATL-HPA068429)
Datasheet Anti GXYLT2 pAb (ATL-HPA068429) Datasheet (External Link)
Vendor Page Anti GXYLT2 pAb (ATL-HPA068429)