Anti GVQW1 pAb (ATL-HPA074576)

Atlas Antibodies

Catalog No.:
ATL-HPA074576-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GVQW motif containing 1
Gene Name: GVQW1
Alternative Gene Name: bA205M20.5, TIGD1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079560: 30%, ENSRNOG00000012197: 33%
Entrez Gene ID:
Uniprot ID: Q8N7I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS
Gene Sequence STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS
Gene ID - Mouse ENSMUSG00000079560
Gene ID - Rat ENSRNOG00000012197
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GVQW1 pAb (ATL-HPA074576)
Datasheet Anti GVQW1 pAb (ATL-HPA074576) Datasheet (External Link)
Vendor Page Anti GVQW1 pAb (ATL-HPA074576) at Atlas Antibodies

Documents & Links for Anti GVQW1 pAb (ATL-HPA074576)
Datasheet Anti GVQW1 pAb (ATL-HPA074576) Datasheet (External Link)
Vendor Page Anti GVQW1 pAb (ATL-HPA074576)