Anti GUSB pAb (ATL-HPA036323)

Atlas Antibodies

Catalog No.:
ATL-HPA036323-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glucuronidase, beta
Gene Name: GUSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025534: 76%, ENSRNOG00000000913: 77%
Entrez Gene ID: 2990
Uniprot ID: P08236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMV
Gene Sequence TSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMV
Gene ID - Mouse ENSMUSG00000025534
Gene ID - Rat ENSRNOG00000000913
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GUSB pAb (ATL-HPA036323)
Datasheet Anti GUSB pAb (ATL-HPA036323) Datasheet (External Link)
Vendor Page Anti GUSB pAb (ATL-HPA036323) at Atlas Antibodies

Documents & Links for Anti GUSB pAb (ATL-HPA036323)
Datasheet Anti GUSB pAb (ATL-HPA036323) Datasheet (External Link)
Vendor Page Anti GUSB pAb (ATL-HPA036323)