Anti GUSB pAb (ATL-HPA036323)
Atlas Antibodies
- SKU:
- ATL-HPA036323-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GUSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025534: 76%, ENSRNOG00000000913: 77%
Entrez Gene ID: 2990
Uniprot ID: P08236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMV |
Gene Sequence | TSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMV |
Gene ID - Mouse | ENSMUSG00000025534 |
Gene ID - Rat | ENSRNOG00000000913 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GUSB pAb (ATL-HPA036323) | |
Datasheet | Anti GUSB pAb (ATL-HPA036323) Datasheet (External Link) |
Vendor Page | Anti GUSB pAb (ATL-HPA036323) at Atlas Antibodies |
Documents & Links for Anti GUSB pAb (ATL-HPA036323) | |
Datasheet | Anti GUSB pAb (ATL-HPA036323) Datasheet (External Link) |
Vendor Page | Anti GUSB pAb (ATL-HPA036323) |