Anti GUSB pAb (ATL-HPA036322 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036322-25
  • Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA036322 antibody. Corresponding GUSB RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GUSB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400064).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glucuronidase, beta
Gene Name: GUSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025534: 82%, ENSRNOG00000000913: 78%
Entrez Gene ID: 2990
Uniprot ID: P08236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS
Gene Sequence GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS
Gene ID - Mouse ENSMUSG00000025534
Gene ID - Rat ENSRNOG00000000913
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GUSB pAb (ATL-HPA036322 w/enhanced validation)
Datasheet Anti GUSB pAb (ATL-HPA036322 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GUSB pAb (ATL-HPA036322 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GUSB pAb (ATL-HPA036322 w/enhanced validation)
Datasheet Anti GUSB pAb (ATL-HPA036322 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GUSB pAb (ATL-HPA036322 w/enhanced validation)