Anti GUK1 pAb (ATL-HPA068324)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068324-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GUK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020444: 92%, ENSRNOG00000002928: 92%
Entrez Gene ID: 2987
Uniprot ID: Q16774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD |
| Gene Sequence | RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD |
| Gene ID - Mouse | ENSMUSG00000020444 |
| Gene ID - Rat | ENSRNOG00000002928 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GUK1 pAb (ATL-HPA068324) | |
| Datasheet | Anti GUK1 pAb (ATL-HPA068324) Datasheet (External Link) |
| Vendor Page | Anti GUK1 pAb (ATL-HPA068324) at Atlas Antibodies |
| Documents & Links for Anti GUK1 pAb (ATL-HPA068324) | |
| Datasheet | Anti GUK1 pAb (ATL-HPA068324) Datasheet (External Link) |
| Vendor Page | Anti GUK1 pAb (ATL-HPA068324) |