Anti GUK1 pAb (ATL-HPA068324)

Atlas Antibodies

Catalog No.:
ATL-HPA068324-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: guanylate kinase 1
Gene Name: GUK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020444: 92%, ENSRNOG00000002928: 92%
Entrez Gene ID: 2987
Uniprot ID: Q16774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD
Gene Sequence RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD
Gene ID - Mouse ENSMUSG00000020444
Gene ID - Rat ENSRNOG00000002928
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GUK1 pAb (ATL-HPA068324)
Datasheet Anti GUK1 pAb (ATL-HPA068324) Datasheet (External Link)
Vendor Page Anti GUK1 pAb (ATL-HPA068324) at Atlas Antibodies

Documents & Links for Anti GUK1 pAb (ATL-HPA068324)
Datasheet Anti GUK1 pAb (ATL-HPA068324) Datasheet (External Link)
Vendor Page Anti GUK1 pAb (ATL-HPA068324)