Anti GUCY1A3 pAb (ATL-HPA058617)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058617-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GUCY1A3
Alternative Gene Name: GC-SA3, GUC1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033910: 84%, ENSRNOG00000012302: 84%
Entrez Gene ID: 2982
Uniprot ID: Q02108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR |
| Gene Sequence | PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR |
| Gene ID - Mouse | ENSMUSG00000033910 |
| Gene ID - Rat | ENSRNOG00000012302 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GUCY1A3 pAb (ATL-HPA058617) | |
| Datasheet | Anti GUCY1A3 pAb (ATL-HPA058617) Datasheet (External Link) |
| Vendor Page | Anti GUCY1A3 pAb (ATL-HPA058617) at Atlas Antibodies |
| Documents & Links for Anti GUCY1A3 pAb (ATL-HPA058617) | |
| Datasheet | Anti GUCY1A3 pAb (ATL-HPA058617) Datasheet (External Link) |
| Vendor Page | Anti GUCY1A3 pAb (ATL-HPA058617) |