Anti GUCY1A3 pAb (ATL-HPA056004)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056004-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GUCY1A3
Alternative Gene Name: GC-SA3, GUC1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033910: 85%, ENSRNOG00000012302: 85%
Entrez Gene ID: 2982
Uniprot ID: Q02108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLM |
Gene Sequence | NSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLM |
Gene ID - Mouse | ENSMUSG00000033910 |
Gene ID - Rat | ENSRNOG00000012302 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GUCY1A3 pAb (ATL-HPA056004) | |
Datasheet | Anti GUCY1A3 pAb (ATL-HPA056004) Datasheet (External Link) |
Vendor Page | Anti GUCY1A3 pAb (ATL-HPA056004) at Atlas Antibodies |
Documents & Links for Anti GUCY1A3 pAb (ATL-HPA056004) | |
Datasheet | Anti GUCY1A3 pAb (ATL-HPA056004) Datasheet (External Link) |
Vendor Page | Anti GUCY1A3 pAb (ATL-HPA056004) |