Anti GUCA1B pAb (ATL-HPA055479)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055479-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GUCA1B
Alternative Gene Name: GCAP2, RP48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023979: 90%, ENSRNOG00000015623: 90%
Entrez Gene ID: 2979
Uniprot ID: Q9UMX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG |
Gene Sequence | GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG |
Gene ID - Mouse | ENSMUSG00000023979 |
Gene ID - Rat | ENSRNOG00000015623 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GUCA1B pAb (ATL-HPA055479) | |
Datasheet | Anti GUCA1B pAb (ATL-HPA055479) Datasheet (External Link) |
Vendor Page | Anti GUCA1B pAb (ATL-HPA055479) at Atlas Antibodies |
Documents & Links for Anti GUCA1B pAb (ATL-HPA055479) | |
Datasheet | Anti GUCA1B pAb (ATL-HPA055479) Datasheet (External Link) |
Vendor Page | Anti GUCA1B pAb (ATL-HPA055479) |