Anti GUCA1B pAb (ATL-HPA055479)

Atlas Antibodies

Catalog No.:
ATL-HPA055479-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: guanylate cyclase activator 1B
Gene Name: GUCA1B
Alternative Gene Name: GCAP2, RP48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023979: 90%, ENSRNOG00000015623: 90%
Entrez Gene ID: 2979
Uniprot ID: Q9UMX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG
Gene Sequence GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG
Gene ID - Mouse ENSMUSG00000023979
Gene ID - Rat ENSRNOG00000015623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GUCA1B pAb (ATL-HPA055479)
Datasheet Anti GUCA1B pAb (ATL-HPA055479) Datasheet (External Link)
Vendor Page Anti GUCA1B pAb (ATL-HPA055479) at Atlas Antibodies

Documents & Links for Anti GUCA1B pAb (ATL-HPA055479)
Datasheet Anti GUCA1B pAb (ATL-HPA055479) Datasheet (External Link)
Vendor Page Anti GUCA1B pAb (ATL-HPA055479)