Anti GTSF1 pAb (ATL-HPA038877 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038877-25

• 
• 
• 

Protein Description: gametocyte specific factor 1
Gene Name: GTSF1
Alternative Gene Name: FAM112B, FLJ32942
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022487: 86%, ENSRNOG00000036831: 86%
Entrez Gene ID: 121355
Uniprot ID: Q8WW33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYV
• Gene Sequence: QTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYV
• Gene ID - Mouse: ENSMUSG00000022487
• Gene ID - Rat: ENSRNOG00000036831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.