Anti GTPBP8 pAb (ATL-HPA058631)

Atlas Antibodies

Catalog No.:
ATL-HPA058631-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GTP-binding protein 8 (putative)
Gene Name: GTPBP8
Alternative Gene Name: HSPC135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022668: 92%, ENSRNOG00000002044: 91%
Entrez Gene ID: 29083
Uniprot ID: Q8N3Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIKALFSLAPEVEVRVSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMVETYLKERRNL
Gene Sequence LIKALFSLAPEVEVRVSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMVETYLKERRNL
Gene ID - Mouse ENSMUSG00000022668
Gene ID - Rat ENSRNOG00000002044
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTPBP8 pAb (ATL-HPA058631)
Datasheet Anti GTPBP8 pAb (ATL-HPA058631) Datasheet (External Link)
Vendor Page Anti GTPBP8 pAb (ATL-HPA058631) at Atlas Antibodies

Documents & Links for Anti GTPBP8 pAb (ATL-HPA058631)
Datasheet Anti GTPBP8 pAb (ATL-HPA058631) Datasheet (External Link)
Vendor Page Anti GTPBP8 pAb (ATL-HPA058631)