Anti GTPBP4 pAb (ATL-HPA056468)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056468-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GTPBP4
Alternative Gene Name: CRFG, FLJ10686, FLJ10690, NGB, NOG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021149: 89%, ENSRNOG00000016217: 89%
Entrez Gene ID: 23560
Uniprot ID: Q9BZE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAI |
| Gene Sequence | TRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAI |
| Gene ID - Mouse | ENSMUSG00000021149 |
| Gene ID - Rat | ENSRNOG00000016217 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTPBP4 pAb (ATL-HPA056468) | |
| Datasheet | Anti GTPBP4 pAb (ATL-HPA056468) Datasheet (External Link) |
| Vendor Page | Anti GTPBP4 pAb (ATL-HPA056468) at Atlas Antibodies |
| Documents & Links for Anti GTPBP4 pAb (ATL-HPA056468) | |
| Datasheet | Anti GTPBP4 pAb (ATL-HPA056468) Datasheet (External Link) |
| Vendor Page | Anti GTPBP4 pAb (ATL-HPA056468) |