Anti GTPBP2 pAb (ATL-HPA031418)

Atlas Antibodies

Catalog No.:
ATL-HPA031418-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GTP binding protein 2
Gene Name: GTPBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023952: 100%, ENSRNOG00000019332: 100%
Entrez Gene ID: 54676
Uniprot ID: Q9BX10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEM
Gene Sequence EFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEM
Gene ID - Mouse ENSMUSG00000023952
Gene ID - Rat ENSRNOG00000019332
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTPBP2 pAb (ATL-HPA031418)
Datasheet Anti GTPBP2 pAb (ATL-HPA031418) Datasheet (External Link)
Vendor Page Anti GTPBP2 pAb (ATL-HPA031418) at Atlas Antibodies

Documents & Links for Anti GTPBP2 pAb (ATL-HPA031418)
Datasheet Anti GTPBP2 pAb (ATL-HPA031418) Datasheet (External Link)
Vendor Page Anti GTPBP2 pAb (ATL-HPA031418)