Anti GTPBP1 pAb (ATL-HPA064702)

Atlas Antibodies

Catalog No.:
ATL-HPA064702-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GTP binding protein 1
Gene Name: GTPBP1
Alternative Gene Name: GP-1, HSPC018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042535: 100%, ENSRNOG00000014634: 100%
Entrez Gene ID: 9567
Uniprot ID: O00178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQ
Gene Sequence SKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQ
Gene ID - Mouse ENSMUSG00000042535
Gene ID - Rat ENSRNOG00000014634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTPBP1 pAb (ATL-HPA064702)
Datasheet Anti GTPBP1 pAb (ATL-HPA064702) Datasheet (External Link)
Vendor Page Anti GTPBP1 pAb (ATL-HPA064702) at Atlas Antibodies

Documents & Links for Anti GTPBP1 pAb (ATL-HPA064702)
Datasheet Anti GTPBP1 pAb (ATL-HPA064702) Datasheet (External Link)
Vendor Page Anti GTPBP1 pAb (ATL-HPA064702)