Anti GTPBP1 pAb (ATL-HPA064702)

Atlas Antibodies

Catalog No.: ATL-HPA064702-25

Protein Description: GTP binding protein 1
Gene Name: GTPBP1
Alternative Gene Name: GP-1, HSPC018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042535: 100%, ENSRNOG00000014634: 100%
Entrez Gene ID: 9567
Uniprot ID: O00178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQ
• Gene Sequence: SKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQ
• Gene ID - Mouse: ENSMUSG00000042535
• Gene ID - Rat: ENSRNOG00000014634
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.