Anti GTF3C6 pAb (ATL-HPA061345)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061345-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GTF3C6
Alternative Gene Name: bA397G5.3, C6orf51, TFIIIC35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019837: 50%, ENSRNOG00000000586: 41%
Entrez Gene ID: 112495
Uniprot ID: Q969F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP |
Gene Sequence | DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP |
Gene ID - Mouse | ENSMUSG00000019837 |
Gene ID - Rat | ENSRNOG00000000586 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GTF3C6 pAb (ATL-HPA061345) | |
Datasheet | Anti GTF3C6 pAb (ATL-HPA061345) Datasheet (External Link) |
Vendor Page | Anti GTF3C6 pAb (ATL-HPA061345) at Atlas Antibodies |
Documents & Links for Anti GTF3C6 pAb (ATL-HPA061345) | |
Datasheet | Anti GTF3C6 pAb (ATL-HPA061345) Datasheet (External Link) |
Vendor Page | Anti GTF3C6 pAb (ATL-HPA061345) |