Anti GTF3C6 pAb (ATL-HPA061345)

Atlas Antibodies

Catalog No.:
ATL-HPA061345-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIIC, polypeptide 6, alpha 35kDa
Gene Name: GTF3C6
Alternative Gene Name: bA397G5.3, C6orf51, TFIIIC35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019837: 50%, ENSRNOG00000000586: 41%
Entrez Gene ID: 112495
Uniprot ID: Q969F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Gene Sequence DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Gene ID - Mouse ENSMUSG00000019837
Gene ID - Rat ENSRNOG00000000586
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTF3C6 pAb (ATL-HPA061345)
Datasheet Anti GTF3C6 pAb (ATL-HPA061345) Datasheet (External Link)
Vendor Page Anti GTF3C6 pAb (ATL-HPA061345) at Atlas Antibodies

Documents & Links for Anti GTF3C6 pAb (ATL-HPA061345)
Datasheet Anti GTF3C6 pAb (ATL-HPA061345) Datasheet (External Link)
Vendor Page Anti GTF3C6 pAb (ATL-HPA061345)