Anti GTF3C6 pAb (ATL-HPA061345)

Atlas Antibodies

Catalog No.: ATL-HPA061345-25

Protein Description: general transcription factor IIIC, polypeptide 6, alpha 35kDa
Gene Name: GTF3C6
Alternative Gene Name: bA397G5.3, C6orf51, TFIIIC35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019837: 50%, ENSRNOG00000000586: 41%
Entrez Gene ID: 112495
Uniprot ID: Q969F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
• Gene Sequence: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
• Gene ID - Mouse: ENSMUSG00000019837
• Gene ID - Rat: ENSRNOG00000000586
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.