Anti GTF2IRD2B pAb (ATL-HPA056679)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056679-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GTF2IRD2B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015942: 88%, ENSRNOG00000018940: 28%
Entrez Gene ID: 389524
Uniprot ID: Q6EKJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHF |
Gene Sequence | DSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHF |
Gene ID - Mouse | ENSMUSG00000015942 |
Gene ID - Rat | ENSRNOG00000018940 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GTF2IRD2B pAb (ATL-HPA056679) | |
Datasheet | Anti GTF2IRD2B pAb (ATL-HPA056679) Datasheet (External Link) |
Vendor Page | Anti GTF2IRD2B pAb (ATL-HPA056679) at Atlas Antibodies |
Documents & Links for Anti GTF2IRD2B pAb (ATL-HPA056679) | |
Datasheet | Anti GTF2IRD2B pAb (ATL-HPA056679) Datasheet (External Link) |
Vendor Page | Anti GTF2IRD2B pAb (ATL-HPA056679) |