Anti GTF2IRD2B pAb (ATL-HPA056679)

Atlas Antibodies

Catalog No.:
ATL-HPA056679-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GTF2I repeat domain containing 2B
Gene Name: GTF2IRD2B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015942: 88%, ENSRNOG00000018940: 28%
Entrez Gene ID: 389524
Uniprot ID: Q6EKJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHF
Gene Sequence DSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHF
Gene ID - Mouse ENSMUSG00000015942
Gene ID - Rat ENSRNOG00000018940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTF2IRD2B pAb (ATL-HPA056679)
Datasheet Anti GTF2IRD2B pAb (ATL-HPA056679) Datasheet (External Link)
Vendor Page Anti GTF2IRD2B pAb (ATL-HPA056679) at Atlas Antibodies

Documents & Links for Anti GTF2IRD2B pAb (ATL-HPA056679)
Datasheet Anti GTF2IRD2B pAb (ATL-HPA056679) Datasheet (External Link)
Vendor Page Anti GTF2IRD2B pAb (ATL-HPA056679)