Anti GTF2F2 pAb (ATL-HPA006912)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006912-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GTF2F2
Alternative Gene Name: BTF4, RAP30, TFIIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067995: 97%, ENSRNOG00000029316: 97%
Entrez Gene ID: 2963
Uniprot ID: P13984
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEK |
Gene Sequence | YKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEK |
Gene ID - Mouse | ENSMUSG00000067995 |
Gene ID - Rat | ENSRNOG00000029316 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GTF2F2 pAb (ATL-HPA006912) | |
Datasheet | Anti GTF2F2 pAb (ATL-HPA006912) Datasheet (External Link) |
Vendor Page | Anti GTF2F2 pAb (ATL-HPA006912) at Atlas Antibodies |
Documents & Links for Anti GTF2F2 pAb (ATL-HPA006912) | |
Datasheet | Anti GTF2F2 pAb (ATL-HPA006912) Datasheet (External Link) |
Vendor Page | Anti GTF2F2 pAb (ATL-HPA006912) |