Anti GTF2F2 pAb (ATL-HPA006912)

Atlas Antibodies

SKU: ATL-HPA006912-25

• 
• 
• 

Protein Description: general transcription factor IIF, polypeptide 2, 30kDa
Gene Name: GTF2F2
Alternative Gene Name: BTF4, RAP30, TFIIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067995: 97%, ENSRNOG00000029316: 97%
Entrez Gene ID: 2963
Uniprot ID: P13984
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEK
• Gene Sequence: YKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEK
• Gene ID - Mouse: ENSMUSG00000067995
• Gene ID - Rat: ENSRNOG00000029316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.