Anti GTF2F1 pAb (ATL-HPA070752)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070752-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GTF2F1
Alternative Gene Name: BTF4, RAP74, TF2F1, TFIIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002658: 85%, ENSRNOG00000047134: 85%
Entrez Gene ID: 2962
Uniprot ID: P35269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP |
| Gene Sequence | SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP |
| Gene ID - Mouse | ENSMUSG00000002658 |
| Gene ID - Rat | ENSRNOG00000047134 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTF2F1 pAb (ATL-HPA070752) | |
| Datasheet | Anti GTF2F1 pAb (ATL-HPA070752) Datasheet (External Link) |
| Vendor Page | Anti GTF2F1 pAb (ATL-HPA070752) at Atlas Antibodies |
| Documents & Links for Anti GTF2F1 pAb (ATL-HPA070752) | |
| Datasheet | Anti GTF2F1 pAb (ATL-HPA070752) Datasheet (External Link) |
| Vendor Page | Anti GTF2F1 pAb (ATL-HPA070752) |