Anti GTF2F1 pAb (ATL-HPA070752)

Atlas Antibodies

SKU:
ATL-HPA070752-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIF subunit 1
Gene Name: GTF2F1
Alternative Gene Name: BTF4, RAP74, TF2F1, TFIIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002658: 85%, ENSRNOG00000047134: 85%
Entrez Gene ID: 2962
Uniprot ID: P35269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP
Gene Sequence SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP
Gene ID - Mouse ENSMUSG00000002658
Gene ID - Rat ENSRNOG00000047134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2F1 pAb (ATL-HPA070752)
Datasheet Anti GTF2F1 pAb (ATL-HPA070752) Datasheet (External Link)
Vendor Page Anti GTF2F1 pAb (ATL-HPA070752) at Atlas Antibodies

Documents & Links for Anti GTF2F1 pAb (ATL-HPA070752)
Datasheet Anti GTF2F1 pAb (ATL-HPA070752) Datasheet (External Link)
Vendor Page Anti GTF2F1 pAb (ATL-HPA070752)