Anti GTF2E2 pAb (ATL-HPA025065)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025065-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GTF2E2
Alternative Gene Name: FE, TF2E2, TFIIE-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031585: 91%, ENSRNOG00000014422: 91%
Entrez Gene ID: 2961
Uniprot ID: P29084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL |
| Gene Sequence | PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL |
| Gene ID - Mouse | ENSMUSG00000031585 |
| Gene ID - Rat | ENSRNOG00000014422 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTF2E2 pAb (ATL-HPA025065) | |
| Datasheet | Anti GTF2E2 pAb (ATL-HPA025065) Datasheet (External Link) |
| Vendor Page | Anti GTF2E2 pAb (ATL-HPA025065) at Atlas Antibodies |
| Documents & Links for Anti GTF2E2 pAb (ATL-HPA025065) | |
| Datasheet | Anti GTF2E2 pAb (ATL-HPA025065) Datasheet (External Link) |
| Vendor Page | Anti GTF2E2 pAb (ATL-HPA025065) |
| Citations for Anti GTF2E2 pAb (ATL-HPA025065) – 1 Found |
| Bi, Guoshu; Zhu, Donglin; Bian, Yunyi; Huang, Yiwei; Zhan, Cheng; Yang, Yong; Wang, Qun. Knockdown of GTF2E2 inhibits the growth and progression of lung adenocarcinoma via RPS4X in vitro and in vivo. Cancer Cell International. 2021;21(1):181. PubMed |