Anti GTF2E2 pAb (ATL-HPA025065)

Atlas Antibodies

SKU: ATL-HPA025065-25

• 
• 
• 

Protein Description: general transcription factor IIE, polypeptide 2, beta 34kDa
Gene Name: GTF2E2
Alternative Gene Name: FE, TF2E2, TFIIE-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031585: 91%, ENSRNOG00000014422: 91%
Entrez Gene ID: 2961
Uniprot ID: P29084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
• Gene Sequence: PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
• Gene ID - Mouse: ENSMUSG00000031585
• Gene ID - Rat: ENSRNOG00000014422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GTF2E2 pAb (ATL-HPA025065) – 1 Found

Bi, Guoshu; Zhu, Donglin; Bian, Yunyi; Huang, Yiwei; Zhan, Cheng; Yang, Yong; Wang, Qun. Knockdown of GTF2E2 inhibits the growth and progression of lung adenocarcinoma via RPS4X in vitro and in vivo. Cancer Cell International. 2021;21(1):181.