Anti GTF2E2 pAb (ATL-HPA004816)

Atlas Antibodies

SKU: ATL-HPA004816-25

• 
• 

Protein Description: general transcription factor IIE, polypeptide 2, beta 34kDa
Gene Name: GTF2E2
Alternative Gene Name: FE, TF2E2, TFIIE-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031585: 96%, ENSRNOG00000014422: 96%
Entrez Gene ID: 2961
Uniprot ID: P29084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
• Gene Sequence: LLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
• Gene ID - Mouse: ENSMUSG00000031585
• Gene ID - Rat: ENSRNOG00000014422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.