Anti GTF2E1 pAb (ATL-HPA066881)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066881-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GTF2E1
Alternative Gene Name: FE, TFIIE-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022828: 98%, ENSRNOG00000026008: 95%
Entrez Gene ID: 2960
Uniprot ID: P29083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMP |
| Gene Sequence | RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMP |
| Gene ID - Mouse | ENSMUSG00000022828 |
| Gene ID - Rat | ENSRNOG00000026008 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTF2E1 pAb (ATL-HPA066881) | |
| Datasheet | Anti GTF2E1 pAb (ATL-HPA066881) Datasheet (External Link) |
| Vendor Page | Anti GTF2E1 pAb (ATL-HPA066881) at Atlas Antibodies |
| Documents & Links for Anti GTF2E1 pAb (ATL-HPA066881) | |
| Datasheet | Anti GTF2E1 pAb (ATL-HPA066881) Datasheet (External Link) |
| Vendor Page | Anti GTF2E1 pAb (ATL-HPA066881) |