Anti GTF2E1 pAb (ATL-HPA066881)

Atlas Antibodies

Catalog No.:
ATL-HPA066881-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIE, polypeptide 1, alpha 56kDa
Gene Name: GTF2E1
Alternative Gene Name: FE, TFIIE-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022828: 98%, ENSRNOG00000026008: 95%
Entrez Gene ID: 2960
Uniprot ID: P29083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMP
Gene Sequence RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMP
Gene ID - Mouse ENSMUSG00000022828
Gene ID - Rat ENSRNOG00000026008
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTF2E1 pAb (ATL-HPA066881)
Datasheet Anti GTF2E1 pAb (ATL-HPA066881) Datasheet (External Link)
Vendor Page Anti GTF2E1 pAb (ATL-HPA066881) at Atlas Antibodies

Documents & Links for Anti GTF2E1 pAb (ATL-HPA066881)
Datasheet Anti GTF2E1 pAb (ATL-HPA066881) Datasheet (External Link)
Vendor Page Anti GTF2E1 pAb (ATL-HPA066881)