Anti GTF2A2 pAb (ATL-HPA056239)

Atlas Antibodies

SKU:
ATL-HPA056239-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIA, 2, 12kDa
Gene Name: GTF2A2
Alternative Gene Name: HsT18745, TFIIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033543: 99%, ENSRNOG00000056701: 99%
Entrez Gene ID: 2958
Uniprot ID: P52657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Gene Sequence AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Gene ID - Mouse ENSMUSG00000033543
Gene ID - Rat ENSRNOG00000056701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2A2 pAb (ATL-HPA056239)
Datasheet Anti GTF2A2 pAb (ATL-HPA056239) Datasheet (External Link)
Vendor Page Anti GTF2A2 pAb (ATL-HPA056239) at Atlas Antibodies

Documents & Links for Anti GTF2A2 pAb (ATL-HPA056239)
Datasheet Anti GTF2A2 pAb (ATL-HPA056239) Datasheet (External Link)
Vendor Page Anti GTF2A2 pAb (ATL-HPA056239)