Anti GTF2A2 pAb (ATL-HPA056239)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056239-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GTF2A2
Alternative Gene Name: HsT18745, TFIIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033543: 99%, ENSRNOG00000056701: 99%
Entrez Gene ID: 2958
Uniprot ID: P52657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
| Gene Sequence | AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
| Gene ID - Mouse | ENSMUSG00000033543 |
| Gene ID - Rat | ENSRNOG00000056701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTF2A2 pAb (ATL-HPA056239) | |
| Datasheet | Anti GTF2A2 pAb (ATL-HPA056239) Datasheet (External Link) |
| Vendor Page | Anti GTF2A2 pAb (ATL-HPA056239) at Atlas Antibodies |
| Documents & Links for Anti GTF2A2 pAb (ATL-HPA056239) | |
| Datasheet | Anti GTF2A2 pAb (ATL-HPA056239) Datasheet (External Link) |
| Vendor Page | Anti GTF2A2 pAb (ATL-HPA056239) |