Anti GSTZ1 pAb (ATL-HPA004701)

Atlas Antibodies

SKU: ATL-HPA004701-100

• 
• 
• 

Protein Description: glutathione S-transferase zeta 1
Gene Name: GSTZ1
Alternative Gene Name: GSTZ1-1, MAAI, MAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021033: 81%, ENSRNOG00000047708: 83%
Entrez Gene ID: 2954
Uniprot ID: O43708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
• Gene Sequence: NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
• Gene ID - Mouse: ENSMUSG00000021033
• Gene ID - Rat: ENSRNOG00000047708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GSTZ1 pAb (ATL-HPA004701) – 1 Found

Nguyen, Tran N; Nguyen, Ha Q; Le, Duc-Hau. Unveiling prognostics biomarkers of tyrosine metabolism reprogramming in liver cancer by cross-platform gene expression analyses. Plos One. 15(6):e0229276.