Anti GSTZ1 pAb (ATL-HPA004701)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004701-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GSTZ1
Alternative Gene Name: GSTZ1-1, MAAI, MAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021033: 81%, ENSRNOG00000047708: 83%
Entrez Gene ID: 2954
Uniprot ID: O43708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA |
Gene Sequence | NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA |
Gene ID - Mouse | ENSMUSG00000021033 |
Gene ID - Rat | ENSRNOG00000047708 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GSTZ1 pAb (ATL-HPA004701) | |
Datasheet | Anti GSTZ1 pAb (ATL-HPA004701) Datasheet (External Link) |
Vendor Page | Anti GSTZ1 pAb (ATL-HPA004701) at Atlas Antibodies |
Documents & Links for Anti GSTZ1 pAb (ATL-HPA004701) | |
Datasheet | Anti GSTZ1 pAb (ATL-HPA004701) Datasheet (External Link) |
Vendor Page | Anti GSTZ1 pAb (ATL-HPA004701) |
Citations for Anti GSTZ1 pAb (ATL-HPA004701) – 1 Found |
Nguyen, Tran N; Nguyen, Ha Q; Le, Duc-Hau. Unveiling prognostics biomarkers of tyrosine metabolism reprogramming in liver cancer by cross-platform gene expression analyses. Plos One. 15(6):e0229276. PubMed |