Anti GSTZ1 pAb (ATL-HPA004701)

Atlas Antibodies

Catalog No.:
ATL-HPA004701-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase zeta 1
Gene Name: GSTZ1
Alternative Gene Name: GSTZ1-1, MAAI, MAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021033: 81%, ENSRNOG00000047708: 83%
Entrez Gene ID: 2954
Uniprot ID: O43708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Gene Sequence NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Gene ID - Mouse ENSMUSG00000021033
Gene ID - Rat ENSRNOG00000047708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSTZ1 pAb (ATL-HPA004701)
Datasheet Anti GSTZ1 pAb (ATL-HPA004701) Datasheet (External Link)
Vendor Page Anti GSTZ1 pAb (ATL-HPA004701) at Atlas Antibodies

Documents & Links for Anti GSTZ1 pAb (ATL-HPA004701)
Datasheet Anti GSTZ1 pAb (ATL-HPA004701) Datasheet (External Link)
Vendor Page Anti GSTZ1 pAb (ATL-HPA004701)
Citations for Anti GSTZ1 pAb (ATL-HPA004701) – 1 Found
Nguyen, Tran N; Nguyen, Ha Q; Le, Duc-Hau. Unveiling prognostics biomarkers of tyrosine metabolism reprogramming in liver cancer by cross-platform gene expression analyses. Plos One. 15(6):e0229276.  PubMed