Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019869-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase pi 1
Gene Name: GSTP1
Alternative Gene Name: FAEES3, GST3, GSTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097830: 82%, ENSRNOG00000018237: 90%
Entrez Gene ID: 2950
Uniprot ID: P09211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS
Gene Sequence TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS
Gene ID - Mouse ENSMUSG00000097830
Gene ID - Rat ENSRNOG00000018237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation)
Datasheet Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation)
Datasheet Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation)
Citations for Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) – 2 Found
Ruckhäberle, Eugen; Karn, Thomas; Hanker, Lars; Schwarz, Josef; Schulz-Knappe, Peter; Kuhn, Karsten; Böhm, Gitte; Selzer, Stefan; Erhard, Neukum; Engels, Knut; Holtrich, Uwe; Kaufmann, Manfred; Rody, Achim. Breast Cancer Proteomics - Differences in Protein Expression between Estrogen Receptor-Positive and -Negative Tumors Identified by Tandem Mass Tag Technology. Breast Care (Basel, Switzerland). 2010;5(1):7-10.  PubMed
Bartolini, Desirée; Arato, Iva; Mancuso, Francesca; Giustarini, Daniela; Bellucci, Catia; Vacca, Carmine; Aglietti, Maria Chiara; Stabile, Anna Maria; Rossi, Ranieri; Cruciani, Gabriele; Rende, Mario; Calafiore, Riccardo; Luca, Giovanni; Galli, Francesco. Melatonin modulates Nrf2 activity to protect porcine pre-pubertal Sertoli cells from the abnormal H(2) O(2) generation and reductive stress effects of cadmium. Journal Of Pineal Research. 2022;73(1):e12806.  PubMed