Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019869-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: GSTP1
Alternative Gene Name: FAEES3, GST3, GSTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097830: 82%, ENSRNOG00000018237: 90%
Entrez Gene ID: 2950
Uniprot ID: P09211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS |
| Gene Sequence | TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS |
| Gene ID - Mouse | ENSMUSG00000097830 |
| Gene ID - Rat | ENSRNOG00000018237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) | |
| Datasheet | Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) | |
| Datasheet | Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) |
| Citations for Anti GSTP1 pAb (ATL-HPA019869 w/enhanced validation) – 2 Found |
| Ruckhäberle, Eugen; Karn, Thomas; Hanker, Lars; Schwarz, Josef; Schulz-Knappe, Peter; Kuhn, Karsten; Böhm, Gitte; Selzer, Stefan; Erhard, Neukum; Engels, Knut; Holtrich, Uwe; Kaufmann, Manfred; Rody, Achim. Breast Cancer Proteomics - Differences in Protein Expression between Estrogen Receptor-Positive and -Negative Tumors Identified by Tandem Mass Tag Technology. Breast Care (Basel, Switzerland). 2010;5(1):7-10. PubMed |
| Bartolini, Desirée; Arato, Iva; Mancuso, Francesca; Giustarini, Daniela; Bellucci, Catia; Vacca, Carmine; Aglietti, Maria Chiara; Stabile, Anna Maria; Rossi, Ranieri; Cruciani, Gabriele; Rende, Mario; Calafiore, Riccardo; Luca, Giovanni; Galli, Francesco. Melatonin modulates Nrf2 activity to protect porcine pre-pubertal Sertoli cells from the abnormal H(2) O(2) generation and reductive stress effects of cadmium. Journal Of Pineal Research. 2022;73(1):e12806. PubMed |