Anti GSTO1 pAb (ATL-HPA037604 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037604-25

• 
• 

Protein Description: glutathione S-transferase omega 1
Gene Name: GSTO1
Alternative Gene Name: GSTTLp28, P28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025068: 61%, ENSRNOG00000028746: 72%
Entrez Gene ID: 9446
Uniprot ID: P78417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSIS
• Gene Sequence: AYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSIS
• Gene ID - Mouse: ENSMUSG00000025068
• Gene ID - Rat: ENSRNOG00000028746
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.