Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037603-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/89618/163394/atl-hpa037603_anti-gsto1-pab-atl-hpa037603-wenhanced-validation_45034__25747.1681115599.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GSTO1
Alternative Gene Name: GSTTLp28, P28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025068: 63%, ENSRNOG00000028746: 66%
Entrez Gene ID: 9446
Uniprot ID: P78417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
| Gene Sequence | WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
| Gene ID - Mouse | ENSMUSG00000025068 |
| Gene ID - Rat | ENSRNOG00000028746 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) | |
| Datasheet | Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) | |
| Datasheet | Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) |
| Citations for Anti GSTO1 pAb (ATL-HPA037603 w/enhanced validation) – 1 Found |
| Clotet-Freixas, Sergi; McEvoy, Caitriona M; Batruch, Ihor; Pastrello, Chiara; Kotlyar, Max; Van, Julie Anh Dung; Arambewela, Madhurangi; Boshart, Alex; Farkona, Sofia; Niu, Yun; Li, Yanhong; Famure, Olusegun; Bozovic, Andrea; Kulasingam, Vathany; Chen, Peixuen; Kim, S Joseph; Chan, Emilie; Moshkelgosha, Sajad; Rahman, Syed Ashiqur; Das, Jishnu; Martinu, Tereza; Juvet, Stephen; Jurisica, Igor; Chruscinski, Andrzej; John, Rohan; Konvalinka, Ana. Extracellular Matrix Injury of Kidney Allografts in Antibody-Mediated Rejection: A Proteomics Study. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2705-2724. PubMed |