Anti GSTM3 pAb (ATL-HPA035190 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035190-25

• 

Protein Description: glutathione S-transferase mu 3 (brain)
Gene Name: GSTM3
Alternative Gene Name: GST5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004032: 90%, ENSRNOG00000058357: 86%
Entrez Gene ID: 2947
Uniprot ID: P21266
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN
• Gene Sequence: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN
• Gene ID - Mouse: ENSMUSG00000004032
• Gene ID - Rat: ENSRNOG00000058357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.