Anti GSTM1 pAb (ATL-HPA048652)

Atlas Antibodies

Catalog No.:
ATL-HPA048652-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase mu 1
Gene Name: GSTM1
Alternative Gene Name: GST1, H-B, MU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027890: 45%, ENSRNOG00000047108: 48%
Entrez Gene ID: 2944
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ
Gene Sequence MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ
Gene ID - Mouse ENSMUSG00000027890
Gene ID - Rat ENSRNOG00000047108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSTM1 pAb (ATL-HPA048652)
Datasheet Anti GSTM1 pAb (ATL-HPA048652) Datasheet (External Link)
Vendor Page Anti GSTM1 pAb (ATL-HPA048652) at Atlas Antibodies

Documents & Links for Anti GSTM1 pAb (ATL-HPA048652)
Datasheet Anti GSTM1 pAb (ATL-HPA048652) Datasheet (External Link)
Vendor Page Anti GSTM1 pAb (ATL-HPA048652)