Anti GSTM1 pAb (ATL-HPA048652)

Atlas Antibodies

Catalog No.: ATL-HPA048652-25

Protein Description: glutathione S-transferase mu 1
Gene Name: GSTM1
Alternative Gene Name: GST1, H-B, MU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027890: 45%, ENSRNOG00000047108: 48%
Entrez Gene ID: 2944
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ
• Gene Sequence: MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ
• Gene ID - Mouse: ENSMUSG00000027890
• Gene ID - Rat: ENSRNOG00000047108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.