Anti GSTK1 pAb (ATL-HPA022904)

Atlas Antibodies

Catalog No.:
ATL-HPA022904-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase kappa 1
Gene Name: GSTK1
Alternative Gene Name: GST13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029864: 65%, ENSRNOG00000016484: 62%
Entrez Gene ID: 373156
Uniprot ID: Q9Y2Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNE
Gene Sequence PYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNE
Gene ID - Mouse ENSMUSG00000029864
Gene ID - Rat ENSRNOG00000016484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSTK1 pAb (ATL-HPA022904)
Datasheet Anti GSTK1 pAb (ATL-HPA022904) Datasheet (External Link)
Vendor Page Anti GSTK1 pAb (ATL-HPA022904) at Atlas Antibodies

Documents & Links for Anti GSTK1 pAb (ATL-HPA022904)
Datasheet Anti GSTK1 pAb (ATL-HPA022904) Datasheet (External Link)
Vendor Page Anti GSTK1 pAb (ATL-HPA022904)