Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006311-25
  • Immunohistochemistry analysis in human duodenum and pancreas tissues using HPA006311 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase kappa 1
Gene Name: GSTK1
Alternative Gene Name: GST13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029864: 75%, ENSRNOG00000016484: 77%
Entrez Gene ID: 373156
Uniprot ID: Q9Y2Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN
Gene Sequence QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN
Gene ID - Mouse ENSMUSG00000029864
Gene ID - Rat ENSRNOG00000016484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation)
Datasheet Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation)
Datasheet Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation)



Citations for Anti GSTK1 pAb (ATL-HPA006311 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed