Anti GSTCD pAb (ATL-HPA046160)

Atlas Antibodies

Catalog No.:
ATL-HPA046160-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase, C-terminal domain containing
Gene Name: GSTCD
Alternative Gene Name: FLJ13273
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028018: 91%, ENSRNOG00000011669: 92%
Entrez Gene ID: 79807
Uniprot ID: Q8NEC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRASFVTCPCCYGFIQNTSKFNFPKSEQFKKTLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVI
Gene Sequence TRASFVTCPCCYGFIQNTSKFNFPKSEQFKKTLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVI
Gene ID - Mouse ENSMUSG00000028018
Gene ID - Rat ENSRNOG00000011669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSTCD pAb (ATL-HPA046160)
Datasheet Anti GSTCD pAb (ATL-HPA046160) Datasheet (External Link)
Vendor Page Anti GSTCD pAb (ATL-HPA046160) at Atlas Antibodies

Documents & Links for Anti GSTCD pAb (ATL-HPA046160)
Datasheet Anti GSTCD pAb (ATL-HPA046160) Datasheet (External Link)
Vendor Page Anti GSTCD pAb (ATL-HPA046160)