Anti GSTA1 pAb (ATL-HPA053817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053817-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GSTA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111709: 74%, ENSRNOG00000000201: 74%
Entrez Gene ID: 2938
Uniprot ID: P08263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD |
Gene Sequence | LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD |
Gene ID - Mouse | ENSMUSG00000111709 |
Gene ID - Rat | ENSRNOG00000000201 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GSTA1 pAb (ATL-HPA053817) | |
Datasheet | Anti GSTA1 pAb (ATL-HPA053817) Datasheet (External Link) |
Vendor Page | Anti GSTA1 pAb (ATL-HPA053817) at Atlas Antibodies |
Documents & Links for Anti GSTA1 pAb (ATL-HPA053817) | |
Datasheet | Anti GSTA1 pAb (ATL-HPA053817) Datasheet (External Link) |
Vendor Page | Anti GSTA1 pAb (ATL-HPA053817) |