Anti GSTA1 pAb (ATL-HPA053817)

Atlas Antibodies

Catalog No.:
ATL-HPA053817-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: glutathione S-transferase alpha 1
Gene Name: GSTA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111709: 74%, ENSRNOG00000000201: 74%
Entrez Gene ID: 2938
Uniprot ID: P08263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD
Gene Sequence LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD
Gene ID - Mouse ENSMUSG00000111709
Gene ID - Rat ENSRNOG00000000201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSTA1 pAb (ATL-HPA053817)
Datasheet Anti GSTA1 pAb (ATL-HPA053817) Datasheet (External Link)
Vendor Page Anti GSTA1 pAb (ATL-HPA053817) at Atlas Antibodies

Documents & Links for Anti GSTA1 pAb (ATL-HPA053817)
Datasheet Anti GSTA1 pAb (ATL-HPA053817) Datasheet (External Link)
Vendor Page Anti GSTA1 pAb (ATL-HPA053817)