Anti GSTA1 pAb (ATL-HPA053817)

Atlas Antibodies

Catalog No.: ATL-HPA053817-25

Protein Description: glutathione S-transferase alpha 1
Gene Name: GSTA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111709: 74%, ENSRNOG00000000201: 74%
Entrez Gene ID: 2938
Uniprot ID: P08263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD
• Gene Sequence: LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD
• Gene ID - Mouse: ENSMUSG00000111709
• Gene ID - Rat: ENSRNOG00000000201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.