Anti GSTA1 pAb (ATL-HPA004342)

Atlas Antibodies

SKU: ATL-HPA004342-100

• 
• 

Protein Description: glutathione S-transferase alpha 1
Gene Name: GSTA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025934: 79%, ENSRNOG00000013484: 77%
Entrez Gene ID: 2938
Uniprot ID: P08263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDY
• Gene Sequence: GKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDY
• Gene ID - Mouse: ENSMUSG00000025934
• Gene ID - Rat: ENSRNOG00000013484
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GSTA1 pAb (ATL-HPA004342) – 1 Found

Larsson, Emilia; Mannervik, Bengt; Raffalli-Mathieu, Françoise. Quantitative and selective polymerase chain reaction analysis of highly similar human alpha-class glutathione transferases. Analytical Biochemistry. 2011;412(1):96-101.