Anti GSS pAb (ATL-HPA054508 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA054508-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutathione synthetase
Gene Name: GSS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027610: 93%, ENSRNOG00000018964: 91%
Entrez Gene ID: 2937
Uniprot ID: P48637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI
Gene Sequence NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI
Gene ID - Mouse ENSMUSG00000027610
Gene ID - Rat ENSRNOG00000018964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSS pAb (ATL-HPA054508 w/enhanced validation)
Datasheet Anti GSS pAb (ATL-HPA054508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSS pAb (ATL-HPA054508 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GSS pAb (ATL-HPA054508 w/enhanced validation)
Datasheet Anti GSS pAb (ATL-HPA054508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSS pAb (ATL-HPA054508 w/enhanced validation)
Citations for Anti GSS pAb (ATL-HPA054508 w/enhanced validation) – 1 Found
Anderton, Brittany; Camarda, Roman; Balakrishnan, Sanjeev; Balakrishnan, Asha; Kohnz, Rebecca A; Lim, Lionel; Evason, Kimberley J; Momcilovic, Olga; Kruttwig, Klaus; Huang, Qiang; Xu, Guowang; Nomura, Daniel K; Goga, Andrei. MYC-driven inhibition of the glutamate-cysteine ligase promotes glutathione depletion in liver cancer. Embo Reports. 2017;18(4):569-585.  PubMed