Anti GSPT2 pAb (ATL-HPA044769 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044769-25

• 
• 
• 

Protein Description: G1 to S phase transition 2
Gene Name: GSPT2
Alternative Gene Name: eRF3b, FLJ10441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071723: 63%, ENSRNOG00000048817: 64%
Entrez Gene ID: 23708
Uniprot ID: Q8IYD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
• Gene Sequence: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
• Gene ID - Mouse: ENSMUSG00000071723
• Gene ID - Rat: ENSRNOG00000048817
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.