Anti GSPT1 pAb (ATL-HPA074588)

Atlas Antibodies

Catalog No.:
ATL-HPA074588-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G1 to S phase transition 1
Gene Name: GSPT1
Alternative Gene Name: eRF3a, ETF3A, GST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062203: 100%, ENSRNOG00000046271: 100%
Entrez Gene ID: 2935
Uniprot ID: P15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
Gene Sequence LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
Gene ID - Mouse ENSMUSG00000062203
Gene ID - Rat ENSRNOG00000046271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSPT1 pAb (ATL-HPA074588)
Datasheet Anti GSPT1 pAb (ATL-HPA074588) Datasheet (External Link)
Vendor Page Anti GSPT1 pAb (ATL-HPA074588) at Atlas Antibodies

Documents & Links for Anti GSPT1 pAb (ATL-HPA074588)
Datasheet Anti GSPT1 pAb (ATL-HPA074588) Datasheet (External Link)
Vendor Page Anti GSPT1 pAb (ATL-HPA074588)