Anti GSN pAb (ATL-HPA054026)

Atlas Antibodies

Catalog No.:
ATL-HPA054026-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: gelsolin
Gene Name: GSN
Alternative Gene Name: DKFZp313L0718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026879: 91%, ENSRNOG00000018991: 92%
Entrez Gene ID: 2934
Uniprot ID: P06396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR
Gene Sequence AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR
Gene ID - Mouse ENSMUSG00000026879
Gene ID - Rat ENSRNOG00000018991
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSN pAb (ATL-HPA054026)
Datasheet Anti GSN pAb (ATL-HPA054026) Datasheet (External Link)
Vendor Page Anti GSN pAb (ATL-HPA054026) at Atlas Antibodies

Documents & Links for Anti GSN pAb (ATL-HPA054026)
Datasheet Anti GSN pAb (ATL-HPA054026) Datasheet (External Link)
Vendor Page Anti GSN pAb (ATL-HPA054026)
Citations for Anti GSN pAb (ATL-HPA054026) – 2 Found
Dhar, Neha; Arsiwala, Ammar; Murali, Shruthi; Kane, Ravi S. "Trim"ming PolyQ proteins with engineered PML. Biotechnology And Bioengineering. 2020;117(2):362-371.  PubMed
Yang, Jia-Lian; Wang, Charles C N; Cai, Jia-Hua; Chou, Che-Yi; Lin, Yu-Chao; Hung, Chin-Chuan. Identification of GSN and LAMC2 as Key Prognostic Genes of Bladder Cancer by Integrated Bioinformatics Analysis. Cancers. 2020;12(7)  PubMed