Anti GSG2 pAb (ATL-HPA030698)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030698-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GSG2
Alternative Gene Name: haspin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050107: 38%, ENSRNOG00000048660: 41%
Entrez Gene ID: 83903
Uniprot ID: Q8TF76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP |
Gene Sequence | QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP |
Gene ID - Mouse | ENSMUSG00000050107 |
Gene ID - Rat | ENSRNOG00000048660 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GSG2 pAb (ATL-HPA030698) | |
Datasheet | Anti GSG2 pAb (ATL-HPA030698) Datasheet (External Link) |
Vendor Page | Anti GSG2 pAb (ATL-HPA030698) at Atlas Antibodies |
Documents & Links for Anti GSG2 pAb (ATL-HPA030698) | |
Datasheet | Anti GSG2 pAb (ATL-HPA030698) Datasheet (External Link) |
Vendor Page | Anti GSG2 pAb (ATL-HPA030698) |