Anti GSG2 pAb (ATL-HPA030698)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030698-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GSG2
Alternative Gene Name: haspin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050107: 38%, ENSRNOG00000048660: 41%
Entrez Gene ID: 83903
Uniprot ID: Q8TF76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP |
| Gene Sequence | QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP |
| Gene ID - Mouse | ENSMUSG00000050107 |
| Gene ID - Rat | ENSRNOG00000048660 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GSG2 pAb (ATL-HPA030698) | |
| Datasheet | Anti GSG2 pAb (ATL-HPA030698) Datasheet (External Link) |
| Vendor Page | Anti GSG2 pAb (ATL-HPA030698) at Atlas Antibodies |
| Documents & Links for Anti GSG2 pAb (ATL-HPA030698) | |
| Datasheet | Anti GSG2 pAb (ATL-HPA030698) Datasheet (External Link) |
| Vendor Page | Anti GSG2 pAb (ATL-HPA030698) |