Anti GSG2 pAb (ATL-HPA030698)

Atlas Antibodies

Catalog No.:
ATL-HPA030698-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: germ cell associated 2 (haspin)
Gene Name: GSG2
Alternative Gene Name: haspin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050107: 38%, ENSRNOG00000048660: 41%
Entrez Gene ID: 83903
Uniprot ID: Q8TF76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP
Gene Sequence QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP
Gene ID - Mouse ENSMUSG00000050107
Gene ID - Rat ENSRNOG00000048660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSG2 pAb (ATL-HPA030698)
Datasheet Anti GSG2 pAb (ATL-HPA030698) Datasheet (External Link)
Vendor Page Anti GSG2 pAb (ATL-HPA030698) at Atlas Antibodies

Documents & Links for Anti GSG2 pAb (ATL-HPA030698)
Datasheet Anti GSG2 pAb (ATL-HPA030698) Datasheet (External Link)
Vendor Page Anti GSG2 pAb (ATL-HPA030698)