Anti GSG2 pAb (ATL-HPA027422)

Atlas Antibodies

SKU:
ATL-HPA027422-25
  • Immunohistochemical staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.
  • Western blot analysis in human cell line Daudi.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: germ cell associated 2 (haspin)
Gene Name: GSG2
Alternative Gene Name: haspin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050107: 80%, ENSRNOG00000048660: 80%
Entrez Gene ID: 83903
Uniprot ID: Q8TF76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMK
Gene Sequence QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMK
Gene ID - Mouse ENSMUSG00000050107
Gene ID - Rat ENSRNOG00000048660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GSG2 pAb (ATL-HPA027422)
Datasheet Anti GSG2 pAb (ATL-HPA027422) Datasheet (External Link)
Vendor Page Anti GSG2 pAb (ATL-HPA027422) at Atlas Antibodies

Documents & Links for Anti GSG2 pAb (ATL-HPA027422)
Datasheet Anti GSG2 pAb (ATL-HPA027422) Datasheet (External Link)
Vendor Page Anti GSG2 pAb (ATL-HPA027422)