Anti GSG1L pAb (ATL-HPA014479)

Atlas Antibodies

Catalog No.:
ATL-HPA014479-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GSG1-like
Gene Name: GSG1L
Alternative Gene Name: KTSR5831, MGC18079, PRO19651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046182: 87%, ENSRNOG00000028749: 27%
Entrez Gene ID: 146395
Uniprot ID: Q6UXU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV
Gene Sequence QGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV
Gene ID - Mouse ENSMUSG00000046182
Gene ID - Rat ENSRNOG00000028749
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSG1L pAb (ATL-HPA014479)
Datasheet Anti GSG1L pAb (ATL-HPA014479) Datasheet (External Link)
Vendor Page Anti GSG1L pAb (ATL-HPA014479) at Atlas Antibodies

Documents & Links for Anti GSG1L pAb (ATL-HPA014479)
Datasheet Anti GSG1L pAb (ATL-HPA014479) Datasheet (External Link)
Vendor Page Anti GSG1L pAb (ATL-HPA014479)