Anti GSDMB pAb (ATL-HPA023925)

Atlas Antibodies

Catalog No.:
ATL-HPA023925-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: gasdermin B
Gene Name: GSDMB
Alternative Gene Name: GSDML, PRO2521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017204: 34%, ENSRNOG00000007943: 33%
Entrez Gene ID: 55876
Uniprot ID: Q8TAX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQILDNVDSTGELIVRLPKEIT
Gene Sequence AGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQILDNVDSTGELIVRLPKEIT
Gene ID - Mouse ENSMUSG00000017204
Gene ID - Rat ENSRNOG00000007943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSDMB pAb (ATL-HPA023925)
Datasheet Anti GSDMB pAb (ATL-HPA023925) Datasheet (External Link)
Vendor Page Anti GSDMB pAb (ATL-HPA023925) at Atlas Antibodies

Documents & Links for Anti GSDMB pAb (ATL-HPA023925)
Datasheet Anti GSDMB pAb (ATL-HPA023925) Datasheet (External Link)
Vendor Page Anti GSDMB pAb (ATL-HPA023925)