Anti GRXCR2 pAb (ATL-HPA059421)

Atlas Antibodies

Catalog No.:
ATL-HPA059421-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glutaredoxin, cysteine rich 2
Gene Name: GRXCR2
Alternative Gene Name: DFNB101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073574: 91%, ENSRNOG00000039325: 91%
Entrez Gene ID: 643226
Uniprot ID: A6NFK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLETMDGVYGSGEVPRPQMCSPKL
Gene Sequence KSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLETMDGVYGSGEVPRPQMCSPKL
Gene ID - Mouse ENSMUSG00000073574
Gene ID - Rat ENSRNOG00000039325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRXCR2 pAb (ATL-HPA059421)
Datasheet Anti GRXCR2 pAb (ATL-HPA059421) Datasheet (External Link)
Vendor Page Anti GRXCR2 pAb (ATL-HPA059421) at Atlas Antibodies

Documents & Links for Anti GRXCR2 pAb (ATL-HPA059421)
Datasheet Anti GRXCR2 pAb (ATL-HPA059421) Datasheet (External Link)
Vendor Page Anti GRXCR2 pAb (ATL-HPA059421)
Citations for Anti GRXCR2 pAb (ATL-HPA059421) – 2 Found
Liu, Chang; Luo, Na; Tung, Chun-Yu; Perrin, Benjamin J; Zhao, Bo. GRXCR2 Regulates Taperin Localization Critical for Stereocilia Morphology and Hearing. Cell Reports. 2018;25(5):1268-1280.e4.  PubMed
Liu, Chang; Zhao, Bo. Murine GRXCR1 Has a Different Function Than GRXCR2 in the Morphogenesis of Stereocilia. Frontiers In Cellular Neuroscience. 15( 34366792):714070.  PubMed