Anti GRTP1 pAb (ATL-HPA046201)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046201-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GRTP1
Alternative Gene Name: FLJ22474, TBC1D6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038515: 83%, ENSRNOG00000061995: 89%
Entrez Gene ID: 79774
Uniprot ID: Q5TC63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR |
| Gene Sequence | VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR |
| Gene ID - Mouse | ENSMUSG00000038515 |
| Gene ID - Rat | ENSRNOG00000061995 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GRTP1 pAb (ATL-HPA046201) | |
| Datasheet | Anti GRTP1 pAb (ATL-HPA046201) Datasheet (External Link) |
| Vendor Page | Anti GRTP1 pAb (ATL-HPA046201) at Atlas Antibodies |
| Documents & Links for Anti GRTP1 pAb (ATL-HPA046201) | |
| Datasheet | Anti GRTP1 pAb (ATL-HPA046201) Datasheet (External Link) |
| Vendor Page | Anti GRTP1 pAb (ATL-HPA046201) |