Anti GRM2 pAb (ATL-HPA065166)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065166-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GRM2
Alternative Gene Name: GPRC1B, mGlu2, MGLUR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023192: 97%, ENSRNOG00000013171: 97%
Entrez Gene ID: 2912
Uniprot ID: Q14416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQES |
Gene Sequence | ITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQES |
Gene ID - Mouse | ENSMUSG00000023192 |
Gene ID - Rat | ENSRNOG00000013171 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRM2 pAb (ATL-HPA065166) | |
Datasheet | Anti GRM2 pAb (ATL-HPA065166) Datasheet (External Link) |
Vendor Page | Anti GRM2 pAb (ATL-HPA065166) at Atlas Antibodies |
Documents & Links for Anti GRM2 pAb (ATL-HPA065166) | |
Datasheet | Anti GRM2 pAb (ATL-HPA065166) Datasheet (External Link) |
Vendor Page | Anti GRM2 pAb (ATL-HPA065166) |