Anti GRM2 pAb (ATL-HPA065166)

Atlas Antibodies

Catalog No.:
ATL-HPA065166-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamate receptor, metabotropic 2
Gene Name: GRM2
Alternative Gene Name: GPRC1B, mGlu2, MGLUR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023192: 97%, ENSRNOG00000013171: 97%
Entrez Gene ID: 2912
Uniprot ID: Q14416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQES
Gene Sequence ITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQES
Gene ID - Mouse ENSMUSG00000023192
Gene ID - Rat ENSRNOG00000013171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRM2 pAb (ATL-HPA065166)
Datasheet Anti GRM2 pAb (ATL-HPA065166) Datasheet (External Link)
Vendor Page Anti GRM2 pAb (ATL-HPA065166) at Atlas Antibodies

Documents & Links for Anti GRM2 pAb (ATL-HPA065166)
Datasheet Anti GRM2 pAb (ATL-HPA065166) Datasheet (External Link)
Vendor Page Anti GRM2 pAb (ATL-HPA065166)