Anti GRK4 pAb (ATL-HPA057023)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057023-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GRK4
Alternative Gene Name: GPRK2L, GPRK4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052783: 48%, ENSRNOG00000011847: 50%
Entrez Gene ID: 2868
Uniprot ID: P32298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ |
Gene Sequence | ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ |
Gene ID - Mouse | ENSMUSG00000052783 |
Gene ID - Rat | ENSRNOG00000011847 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRK4 pAb (ATL-HPA057023) | |
Datasheet | Anti GRK4 pAb (ATL-HPA057023) Datasheet (External Link) |
Vendor Page | Anti GRK4 pAb (ATL-HPA057023) at Atlas Antibodies |
Documents & Links for Anti GRK4 pAb (ATL-HPA057023) | |
Datasheet | Anti GRK4 pAb (ATL-HPA057023) Datasheet (External Link) |
Vendor Page | Anti GRK4 pAb (ATL-HPA057023) |