Anti GRK4 pAb (ATL-HPA057023)

Atlas Antibodies

Catalog No.:
ATL-HPA057023-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor kinase 4
Gene Name: GRK4
Alternative Gene Name: GPRK2L, GPRK4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052783: 48%, ENSRNOG00000011847: 50%
Entrez Gene ID: 2868
Uniprot ID: P32298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ
Gene Sequence ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ
Gene ID - Mouse ENSMUSG00000052783
Gene ID - Rat ENSRNOG00000011847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRK4 pAb (ATL-HPA057023)
Datasheet Anti GRK4 pAb (ATL-HPA057023) Datasheet (External Link)
Vendor Page Anti GRK4 pAb (ATL-HPA057023) at Atlas Antibodies

Documents & Links for Anti GRK4 pAb (ATL-HPA057023)
Datasheet Anti GRK4 pAb (ATL-HPA057023) Datasheet (External Link)
Vendor Page Anti GRK4 pAb (ATL-HPA057023)