Anti GRK2 pAb (ATL-HPA048330)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048330-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GRK2
Alternative Gene Name: ADRBK1, BARK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024858: 98%, ENSRNOG00000018985: 98%
Entrez Gene ID: 156
Uniprot ID: P25098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL |
Gene Sequence | LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL |
Gene ID - Mouse | ENSMUSG00000024858 |
Gene ID - Rat | ENSRNOG00000018985 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRK2 pAb (ATL-HPA048330) | |
Datasheet | Anti GRK2 pAb (ATL-HPA048330) Datasheet (External Link) |
Vendor Page | Anti GRK2 pAb (ATL-HPA048330) at Atlas Antibodies |
Documents & Links for Anti GRK2 pAb (ATL-HPA048330) | |
Datasheet | Anti GRK2 pAb (ATL-HPA048330) Datasheet (External Link) |
Vendor Page | Anti GRK2 pAb (ATL-HPA048330) |