Anti GRK2 pAb (ATL-HPA048330)

Atlas Antibodies

Catalog No.:
ATL-HPA048330-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor kinase 2
Gene Name: GRK2
Alternative Gene Name: ADRBK1, BARK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024858: 98%, ENSRNOG00000018985: 98%
Entrez Gene ID: 156
Uniprot ID: P25098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Gene Sequence LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Gene ID - Mouse ENSMUSG00000024858
Gene ID - Rat ENSRNOG00000018985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRK2 pAb (ATL-HPA048330)
Datasheet Anti GRK2 pAb (ATL-HPA048330) Datasheet (External Link)
Vendor Page Anti GRK2 pAb (ATL-HPA048330) at Atlas Antibodies

Documents & Links for Anti GRK2 pAb (ATL-HPA048330)
Datasheet Anti GRK2 pAb (ATL-HPA048330) Datasheet (External Link)
Vendor Page Anti GRK2 pAb (ATL-HPA048330)