Anti GRIP1 pAb (ATL-HPA038856)

Atlas Antibodies

Catalog No.:
ATL-HPA038856-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glutamate receptor interacting protein 1
Gene Name: GRIP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034813: 84%, ENSRNOG00000004013: 87%
Entrez Gene ID: 23426
Uniprot ID: Q9Y3R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSWDGSAIDTSYGTEGTSFQASGYNFNTYDWRSPKQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTAS
Gene Sequence DSWDGSAIDTSYGTEGTSFQASGYNFNTYDWRSPKQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTAS
Gene ID - Mouse ENSMUSG00000034813
Gene ID - Rat ENSRNOG00000004013
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRIP1 pAb (ATL-HPA038856)
Datasheet Anti GRIP1 pAb (ATL-HPA038856) Datasheet (External Link)
Vendor Page Anti GRIP1 pAb (ATL-HPA038856) at Atlas Antibodies

Documents & Links for Anti GRIP1 pAb (ATL-HPA038856)
Datasheet Anti GRIP1 pAb (ATL-HPA038856) Datasheet (External Link)
Vendor Page Anti GRIP1 pAb (ATL-HPA038856)