Anti GRINA pAb (ATL-HPA036981 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036981-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding)
Gene Name: GRINA
Alternative Gene Name: HNRGW, LFG1, NMDARA1, TMBIM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022564: 85%, ENSRNOG00000029941: 85%
Entrez Gene ID: 2907
Uniprot ID: Q7Z429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Gene Sequence PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Gene ID - Mouse ENSMUSG00000022564
Gene ID - Rat ENSRNOG00000029941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRINA pAb (ATL-HPA036981 w/enhanced validation)
Datasheet Anti GRINA pAb (ATL-HPA036981 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRINA pAb (ATL-HPA036981 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GRINA pAb (ATL-HPA036981 w/enhanced validation)
Datasheet Anti GRINA pAb (ATL-HPA036981 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRINA pAb (ATL-HPA036981 w/enhanced validation)
Citations for Anti GRINA pAb (ATL-HPA036981 w/enhanced validation) – 1 Found
Jiménez-González, Víctor; Ogalla-García, Elena; García-Quintanilla, Meritxell; García-Quintanilla, Albert. Deciphering GRINA/Lifeguard1: Nuclear Location, Ca(2+) Homeostasis and Vesicle Transport. International Journal Of Molecular Sciences. 2019;20(16)  PubMed