Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA073344-25

• 

Protein Description: glutamate ionotropic receptor AMPA type subunit 3
Gene Name: GRIA3
Alternative Gene Name: GluA3, GLUR3, GLURC, MRX94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001986: 98%, ENSRNOG00000007682: 98%
Entrez Gene ID: 2892
Uniprot ID: P42263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSEN
• Gene Sequence: MVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSEN
• Gene ID - Mouse: ENSMUSG00000001986
• Gene ID - Rat: ENSRNOG00000007682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.