Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059960-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GRHL3
Alternative Gene Name: SOM, TFCP2L4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037188: 84%, ENSRNOG00000029427: 86%
Entrez Gene ID: 57822
Uniprot ID: Q8TE85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL |
| Gene Sequence | VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL |
| Gene ID - Mouse | ENSMUSG00000037188 |
| Gene ID - Rat | ENSRNOG00000029427 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) | |
| Datasheet | Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) | |
| Datasheet | Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) |
| Citations for Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) – 2 Found |
| Kashgari, Ghaidaa; Venkatesh, Sanan; Refuerzo, Samuel; Pham, Brandon; Bayat, Anita; Klein, Rachel Herndon; Ramos, Raul; Ta, Albert Paul; Plikus, Maksim V; Wang, Ping H; Andersen, Bogi. GRHL3 activates FSCN1 to relax cell-cell adhesions between migrating keratinocytes during wound reepithelialization. Jci Insight. 2021;6(17) PubMed |
| Huang, Huaxing; Liu, Jiafeng; Li, Mingsen; Guo, Huizhen; Zhu, Jin; Zhu, Liqiong; Wu, Siqi; Mo, Kunlun; Huang, Ying; Tan, Jieying; Chen, Chaoqun; Wang, Bofeng; Yu, Yankun; Wang, Li; Liu, Yizhi; Ouyang, Hong. Cis-regulatory chromatin loops analysis identifies GRHL3 as a master regulator of surface epithelium commitment. Science Advances. 2022;8(28):eabo5668. PubMed |