Anti GRHL2 pAb (ATL-HPA062839)

Atlas Antibodies

Catalog No.:
ATL-HPA062839-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: grainyhead-like transcription factor 2
Gene Name: GRHL2
Alternative Gene Name: BOM, DFNA28, FLJ13782, TFCP2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022286: 90%, ENSRNOG00000007000: 90%
Entrez Gene ID: 79977
Uniprot ID: Q6ISB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV
Gene Sequence ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV
Gene ID - Mouse ENSMUSG00000022286
Gene ID - Rat ENSRNOG00000007000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRHL2 pAb (ATL-HPA062839)
Datasheet Anti GRHL2 pAb (ATL-HPA062839) Datasheet (External Link)
Vendor Page Anti GRHL2 pAb (ATL-HPA062839) at Atlas Antibodies

Documents & Links for Anti GRHL2 pAb (ATL-HPA062839)
Datasheet Anti GRHL2 pAb (ATL-HPA062839) Datasheet (External Link)
Vendor Page Anti GRHL2 pAb (ATL-HPA062839)